PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 529aa    MW: 58458.9 Da    PI: 6.9599
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028893genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.22.6e-31206264160
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  ldDgynWrKYGqK+vkg+e+prsYY+Ct  +Cp+kkkve++  d++++ei+Y+g+H h+k
  DCAR_028893 206 LDDGYNWRKYGQKQVKGTENPRSYYKCTVLNCPTKKKVETTL-DGHITEIVYKGNHSHPK 264
                  59****************************************.***************85 PP

2WRKY105.62.6e-33366424159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  DCAR_028893 366 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFVGCPVRKHVERASHDLRAVITTYEGKHNHD 424
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-27195265IPR003657WRKY domain
PROSITE profilePS5081122.458201265IPR003657WRKY domain
SuperFamilySSF1182907.72E-24203265IPR003657WRKY domain
SMARTSM007745.5E-33206264IPR003657WRKY domain
PfamPF031064.9E-23207263IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.4E-37351426IPR003657WRKY domain
SuperFamilySSF1182903.01E-29358426IPR003657WRKY domain
PROSITE profilePS5081137.952361426IPR003657WRKY domain
SMARTSM007746.4E-39366425IPR003657WRKY domain
PfamPF031061.8E-25367424IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MNSSSSSSFG GNMNTSNSET TQPDFTYSAQ FMNSSFTDLL AQPDNNDFGS NWGFDHSKPK  60
PNSHHSALPF SPTNFSPSSF LSFFDSPIQP STSNIVSSST NGNFDGQVLM EGNGNYANVS  120
FPTQARNSME ELMKRQEGDS NMKFFGEGND FSSMTRTVKP ELGVVDRYSP ELSAVRSNVQ  180
ISTALPSSIQ THYTQSSQSS RDQRKLDDGY NWRKYGQKQV KGTENPRSYY KCTVLNCPTK  240
KKVETTLDGH ITEIVYKGNH SHPKPQSTKL SRSYQKPLGS SSDISIQQLD NGYGEHFTTP  300
ENSSASFGDD DAEQGSVSKS GEDNANEPEA KRWKGEYENE ASSALGSRTV REPRIVVQTT  360
SDIDILDDGY RWRKYGQKVV KGNPNPRSYY KCTFVGCPVR KHVERASHDL RAVITTYEGK  420
HNHDVPAPRG SGSYPVIRPS SDGTMASAPM AVRPTTNYTN PLQNTRAPMP NGQAPFTLEM  480
LQGQGNYGLS RFVNSTNTYI NRTQEANVQF AAAKEEPDNE SFFNSFLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-36198427878Probable WRKY transcription factor 4
1wj2_A2e-36198427878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017012.11e-156WRKY DNA-binding protein 33 isoform 1
SwissprotQ8S8P51e-114WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLO816390.0O81639_PIMBR; Zinc finger protein
STRINGPOPTR_0016s13600.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-115WRKY DNA-binding protein 33